PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026139m
Common NameEUTSA_v10026139mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27193.9 Da    PI: 9.4949
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026139mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.6e-261059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri++++ rqvtfskRr+g++KKA+EL +LCdaev +iifsstgkly+++s
  Thhalv10026139m 10 RIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFAS 59
                     8***********************************************86 PP

2K-box713.7e-2481176999
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke.....lqeenkaLrkk 97 
                      + +++ + +q+e+a L++e++ Lq+++R+++Ge+L+ Ls++eL++Le+qLe sl+ iR kK+++l+ +i+el +k  +     +++en +L++k
  Thhalv10026139m  81 NPASEVKFWQREAAVLRQELHALQENHRQIMGEQLNGLSVNELNNLENQLELSLRGIRMKKEQMLTHEIQELSQKVTMryrnlIHQENLELSRK 174
                      567889******************************************************************9998653333367888888888 PP

            K-box  98 le 99 
                      ++
  Thhalv10026139m 175 VQ 176
                      75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-38160IPR002100Transcription factor, MADS-box
CDDcd002651.36E-42278No hitNo description
SuperFamilySSF554551.03E-31288IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.0E-2284175IPR002487Transcription factor, K-box
PROSITE profilePS5129714.71686181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIVIQR IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLIIFSS TGKLYDFASS  60
SMKSVIDRYN KSKIEQQQLL NPASEVKFWQ REAAVLRQEL HALQENHRQI MGEQLNGLSV  120
NELNNLENQL ELSLRGIRMK KEQMLTHEIQ ELSQKVTMRY RNLIHQENLE LSRKVQRIHQ  180
ENVELYKKAY TASTNGFIHR ELAVADDESQ YTQIRLQLSQ PEHSDYETPP RASE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A7e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D7e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A8e-20269168Myocyte-specific enhancer factor 2A
3kov_B8e-20269168Myocyte-specific enhancer factor 2A
3kov_I8e-20269168Myocyte-specific enhancer factor 2A
3kov_J8e-20269168Myocyte-specific enhancer factor 2A
3p57_A8e-20269168Myocyte-specific enhancer factor 2A
3p57_B8e-20269168Myocyte-specific enhancer factor 2A
3p57_C8e-20269168Myocyte-specific enhancer factor 2A
3p57_D8e-20269168Myocyte-specific enhancer factor 2A
3p57_I8e-20269168Myocyte-specific enhancer factor 2A
3p57_J8e-20269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3369790.0AF336979.1 Arabidopsis thaliana MADS-box protein AGL21 mRNA, complete cds.
GenBankBT0248460.0BT024846.1 Arabidopsis thaliana At4g37940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411833.11e-173hypothetical protein EUTSA_v10026139mg
SwissprotQ9SZJ61e-156AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLV4P1R81e-173V4P1R8_EUTSA; Uncharacterized protein
STRINGBra011797.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-141AGAMOUS-like 21